Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, Serotonin receptor 1A

UniProt

Q9N297

Expression Region

1-422

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/1472), 0.2mg/mL
BNUB1472-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1472), 0.2mg/mL

Sign In for Pricing
View Details
SHANK2 (NM_012309) Human Over-expression Lysate
LC432460 20 µg

SHANK2 (NM_012309) Human Over-expression Lysate

Sign In for Pricing
View Details
Ninein (NIN) Human Gene Knockout Kit (CRISPR)
KN415020 1 Kit

Ninein (NIN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ush1c Mouse Gene Knockout Kit (CRISPR)
KN518759 1 Kit

Ush1c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), Biotin conjugate, 0.1mg/mL
BNCB2336-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
7-Keto-3α,12-α-dihydroxycholanic Acid
TRC-K188480-50MG 50 mg

7-Keto-3α,12-α-dihydroxycholanic Acid

Sign In for Pricing
View Details