Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, Serotonin receptor 1A

UniProt

Q9N297

Expression Region

1-422

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC4 Rabbit Polyclonal Antibody
AP06483PU-N 100 µg

XRCC4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tbc1d25 Mouse Gene Knockout Kit (CRISPR)
KN517251 1 Kit

Tbc1d25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tbl1xr1 Mouse Gene Knockout Kit (CRISPR)
KN517274 1 Kit

Tbl1xr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mix-n-StainTM CF®405L Antibody Labeling Kit, 1x (20-50ug) labeling
#92304 1 Kit

Mix-n-StainTM CF®405L Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
p16 ARC Recombinant Rabbit Monoclonal Antibody [SR34-02]
ET1602-9 100 µL

p16 ARC Recombinant Rabbit Monoclonal Antibody [SR34-02]

Sign In for Pricing
View Details
ENaC beta Antibody
SMC-241S 12 µg

ENaC beta Antibody

Sign In for Pricing
View Details