Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Gorilla gorilla gorilla 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, Serotonin receptor 1A

UniProt

Q9N297

Expression Region

1-422

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse VSIG8 Protein (His Tag)
PKSM041182-01 10 µg

Recombinant Mouse VSIG8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse VSIG8 Protein (His Tag)
PKSM041182-02 50 µg

Recombinant Mouse VSIG8 Protein (His Tag)

Sign In for Pricing
View Details
ExoBriteTM 640/660 WGA EV Staining Kit, 500 labelings
#30126 1 Kit

ExoBriteTM 640/660 WGA EV Staining Kit, 500 labelings

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL
BNC742409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aquaporin 1 (AQP1) (NM_198098) Human Over-expression Lysate
LC403670 20 µg

Aquaporin 1 (AQP1) (NM_198098) Human Over-expression Lysate

Sign In for Pricing
View Details
RNASE4 Human Gene Knockout Kit (CRISPR)
KN402124 1 Kit

RNASE4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details