Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Human 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-422.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, G-21, Serotonin receptor 1A

UniProt

P08908

Expression Region

1-422

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2 Antibody
37217 100 µL

PKD2 Antibody

Sign In for Pricing
View Details
Tec (G-5) Alexa Fluor® 488
sc-365533 AF488 200 µg/mL

Tec (G-5) Alexa Fluor® 488

Sign In for Pricing
View Details
TOLL pathway signalling NF-kappaB Relish-like transcription factor/REL1/NF Rabbit Polyclonal Antibody (Cy3)
orb2571517 200 µL

TOLL pathway signalling NF-kappaB Relish-like transcription factor/REL1/NF Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
HMG4/HMGB3 Rabbit Polyclonal Antibody (Biotin)
orb2620230 100 µg

HMG4/HMGB3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TPO Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV663005 1.0 µg DNA

TPO Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
LSG1 Human shRNA Lentiviral Particle (Locus ID 55341)
TL303419V 500 µL Each

LSG1 Human shRNA Lentiviral Particle (Locus ID 55341)

Sign In for Pricing
View Details