Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vulpes vulpes 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Vulpes vulpes 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-423.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, Serotonin receptor 1A

UniProt

Q6XXY0

Expression Region

1-423

Origin

Vulpes vulpes (Red fox)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGLSPGQGNNTTSSEGPFGTRGNATGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKAERKGADA RSGVSPAPQPRKSVNGEPGGREWRQGPGSKAGGPLCTNGAVRRGDDGAALEVIEVHRVGS SKEHLPLPSEAGAIPCAPASFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIVRCKFC RRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP hsa-mir-3936 AAV miRNA Vector
Amh1061000 500 ng

GFP hsa-mir-3936 AAV miRNA Vector

Sign In for Pricing
View Details
Snx2 siRNA Oligos set (Rat)
45061176 3x 5 nmol

Snx2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
PE-conjugated Mouse Anti-Human IgG H&L
HY-P89357 1 Each

PE-conjugated Mouse Anti-Human IgG H&L

Sign In for Pricing
View Details
NHP2L2 Rabbit Polyclonal Antibody (BF750)
orb2471474 100 µL

NHP2L2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Leptospira biflexa serovar Patoc Elongation factor Ts (tsf)
MBS1060112-01 0.02 mg (E-Coli)

Recombinant Leptospira biflexa serovar Patoc Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Leptospira biflexa serovar Patoc Elongation factor Ts (tsf)
MBS1060112-02 0.1 mg (E-Coli)

Recombinant Leptospira biflexa serovar Patoc Elongation factor Ts (tsf)

Sign In for Pricing
View Details