Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog 5-hydroxytryptamine receptor 1A (HTR1A)

This Recombinant Dog 5-hydroxytryptamine receptor 1A (HTR1A) spans the amino acid sequence from region 1-423.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1A, 5-HT-1A, 5-HT1A, Serotonin receptor 1A

UniProt

Q6XXX9

Expression Region

1-423

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGLSPRQGNNTTSSEGPFGTLGNATGISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKAERKGADA RSGVSPAPQPRKSVNGEPGGREWRQGPGSQAGGPLCTNGAVRRGDDGAALEVIEVHRVGS SKEHLPLPCEAGAIPCAPASFEKKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIVRCKFC RRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AASDH Protein Vector (Human) (pPM-C-HA)
10999022 500 ng

AASDH Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Fibronectin, Human (314a.a, HEK293, His)
HY-P700991-01 20 µg

Fibronectin, Human (314a.a, HEK293, His)

Sign In for Pricing
View Details
Fibronectin, Human (314a.a, HEK293, His)
HY-P700991-02 50 µg

Fibronectin, Human (314a.a, HEK293, His)

Sign In for Pricing
View Details
Fibronectin, Human (314a.a, HEK293, His)
HY-P700991-03 100 µg

Fibronectin, Human (314a.a, HEK293, His)

Sign In for Pricing
View Details
Recombinant Clavibacter michiganensis subsp. sepedonicus Ribosome-recycling factor (frr)
MBS1064298-01 0.02 mg (E-Coli)

Recombinant Clavibacter michiganensis subsp. sepedonicus Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Clavibacter michiganensis subsp. sepedonicus Ribosome-recycling factor (frr)
MBS1064298-02 0.1 mg (E-Coli)

Recombinant Clavibacter michiganensis subsp. sepedonicus Ribosome-recycling factor (frr)

Sign In for Pricing
View Details