Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Orexin/Hypocretin receptor type 1 (HCRTR1)

This Recombinant Human Orexin/Hypocretin receptor type 1 (HCRTR1) spans the amino acid sequence from region 1-425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hypocretin receptor type 1; Orexin receptor type 1

UniProt

O43613

Expression Region

1-425aa

Tag

N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 8 (FGF8) Mouse ELISA Kit
D4377 96 Tests

Fibroblast Growth Factor 8 (FGF8) Mouse ELISA Kit

Sign In for Pricing
View Details
Pfkfb3 Mouse shRNA Plasmid (Locus ID 170768)
TL517196 1 Kit

Pfkfb3 Mouse shRNA Plasmid (Locus ID 170768)

Sign In for Pricing
View Details
L-Asparagine monohydrate for cell biology
1204KG001 1 Kg

L-Asparagine monohydrate for cell biology

Sign In for Pricing
View Details
Rabbit Polyclonal Jumonji/JARID2 Antibody [Alexa Fluor 647]
NBP3-00588AF647 0.1 mL

Rabbit Polyclonal Jumonji/JARID2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
TTC4 Protein Lysate (Mouse) with C-HA Tag
48701035 100 µg

TTC4 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Olr1539 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
34018066 1.0 µg DNA

Olr1539 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details