Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lachancea kluyveri Pheromone alpha factor receptor (STE2)

This Recombinant Lachancea kluyveri Pheromone alpha factor receptor (STE2) spans the amino acid sequence from region 1-426.

Product Specifications

Product Name Alternative

Pheromone alpha factor receptor

UniProt

P12384

Expression Region

1-426

Origin

Lachancea kluyveri (Yeast) (Saccharomyces kluyveri)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKQDLSPLGLYSSYDPTKGLISYTSLYGSGTTVTFEELQIFVNKKITQGILFGTRIGA AGLAIIVLWMVSKNRKTPIFIINQISLFLILLHSSLFLRYLLGDYASVVFNFTLFSQSIS RNDVHVYGATNMIQVLLVAAVEISLIFQVRVIFKGDSYKGVGRILTSISAVLGFTTVVMY FITAVKSMTSVYSDLTKTSDRYFFNIASILLSSSVNFMTLLLTVKLILAVRSRRFLGLKQ FDSFHVLLIMSFQTLIFPSILFILAYALNPNQGTDTLTSIATLLVTLSLPLSSMWATSAN NSSHPSSINTQFRQRNYDDVSFKTGITSFYSESSKPSSKYRHTNNLYDLYPVSRTSNSRC NGYPNDGSKLAPNPNCVGHNGSTMSVNDKNGAHATCVQNNVTLNTDSTLNYSNVDTQDTS KILMTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadm1 (NM_207675) Mouse Tagged ORF Clone Lentiviral Particle
MR222732L3V 200 µL

Cadm1 (NM_207675) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
H2al1o (NM_001085517) Mouse Tagged Lenti ORF Clone
MR214231L3 10 µg

H2al1o (NM_001085517) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rno-miR-3573-5p miRNA Mimic
orb1873637-01 5 nmol

Rno-miR-3573-5p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-3573-5p miRNA Mimic
orb1873637-02 10 nmol

Rno-miR-3573-5p miRNA Mimic

Sign In for Pricing
View Details
NAD-Dependent Protein Lipoamidase Sirtuin-4, Mitochondrial (SIRT4) Antibody
abx213088-01 50 µL

NAD-Dependent Protein Lipoamidase Sirtuin-4, Mitochondrial (SIRT4) Antibody

Sign In for Pricing
View Details
NAD-Dependent Protein Lipoamidase Sirtuin-4, Mitochondrial (SIRT4) Antibody
abx213088-02 100 µL

NAD-Dependent Protein Lipoamidase Sirtuin-4, Mitochondrial (SIRT4) Antibody

Sign In for Pricing
View Details