Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vasoactive intestinal polypeptide receptor 1 (VIPR1)

This Recombinant Human Vasoactive intestinal polypeptide receptor 1 (VIPR1) spans the amino acid sequence from region 31-457.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 1, VIP-R-1, Pituitary adenylate cyclase-activating polypeptide type II receptor, PACAP type II receptor, PACAP-R

UniProt

P32241

Expression Region

31-457

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIF KLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY GLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGESDQCSE GSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSTFT MVWTIARIHFEDYGCWDTINSSLWWIIKGPILTSILVNFILFICIIRILLQKLRPPDIRK SDSSPYSRLARSTLLLIPLFGVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCF LNGEVQAELRRKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSF QAEVSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm11757 Protein Vector (Mouse) (pPB-N-His)
PV182759 500 ng

Gm11757 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Beta Tubulin Mouse Monoclonal Antibody (FITC)
orb2607867 100 µg

Beta Tubulin Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
FAM111A Protein Vector (Mouse) (pPM-C-HA)
19716024 500 ng

FAM111A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RPS6KA3 (NM_004586) Human Over-expression Lysate
E45H07272-2 20 µg

RPS6KA3 (NM_004586) Human Over-expression Lysate

Sign In for Pricing
View Details
Kif2a (NM_008442) Mouse Tagged ORF Clone
MR217995 10 µg

Kif2a (NM_008442) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Xpress™ Human NUDT3 Over-expressing Stable Cell Line
ABC-X2131 1 Vial

Xpress™ Human NUDT3 Over-expressing Stable Cell Line

Sign In for Pricing
View Details