Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Cholecystokinin receptor type A (CCKAR)

This Recombinant Rabbit Cholecystokinin receptor type A (CCKAR) spans the amino acid sequence from region 1-427.

Product Specifications

Product Name Alternative

Cholecystokinin receptor type A, CCK-A receptor, CCK-AR, Cholecystokinin-1 receptor, CCK1-R

UniProt

O97772

Expression Region

1-427

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAVASLLGNASGIPPPCELGLDNETLFCLDQPPPSKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAISDLMLCLFCMPFNLIPNLLKDFIFGSALCKTTTYL MGTSVSVSTLNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFAIMTPYPIYS NLVPFTKTNNQTANMCRFLLPSDVMQQAWHTFLLLILFLIPGIVMMVAYGMISLELYQGI KFDASQKKSAKERKASTGSGRFEDNDGCYLQRSKPTRQLELQQLSGGGGGRVSRIRSSSS AATLMAKKRVIRMLMVIVVLFFLCWMPIFSANAWRAYDTVSAERRLSGTPISFILLLSYT SSCVNPIIYCFMNRRFRLGFMATFPCCPNPGPPGPRAEAGEEEEGRTTRASLSRYSYSHM SASAPPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F1, phosphorylated (H357) (E2F1, RBBP3, Transcription factor E2F1, PBR3, PRB-binding protein E2F-1, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3) (Azide free) (HRP) discontinued
034887-HRP 200 µL

E2F1, phosphorylated (H357) (E2F1, RBBP3, Transcription factor E2F1, PBR3, PRB-binding protein E2F-1, Retinoblastoma-associated protein 1, Retinoblastoma-binding protein 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CCDC124 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8083R-BF750-01 20 µL

CCDC124 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
CCDC124 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-8083R-BF750-02 100 µL

CCDC124 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Mlx sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
30216114 3x 1.0 µg

Mlx sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Quinidine hydrochloride monohydrate (Standard)
HY-B1302R-01 5 mg

Quinidine hydrochloride monohydrate (Standard)

Sign In for Pricing
View Details
Quinidine hydrochloride monohydrate (Standard)
HY-B1302R-02 10 mg

Quinidine hydrochloride monohydrate (Standard)

Sign In for Pricing
View Details