Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Somatostatin receptor type 3 (Sstr3)

This Recombinant Rat Somatostatin receptor type 3 (Sstr3) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Somatostatin receptor type 3, SS-3-R, SS3-R, SS3R, SSR-28

UniProt

P30936

Expression Region

1-428

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGL LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVV VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRVRSQEPGSGPPEKTEEE EDEEEEERREEEERRMQRGQEMNGRLSQIAQPGPSGQQQRPCTGTAKEQQLLPQEATAGD KASTLSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casp6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3423906 1.0 µg DNA

Casp6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit
MBS9339896-01 48 Well

Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit

Sign In for Pricing
View Details
Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit
MBS9339896-02 96 Well

Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit

Sign In for Pricing
View Details
Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit
MBS9339896-03 5x 96 Well

Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit

Sign In for Pricing
View Details
Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit
MBS9339896-04 10x 96 Well

Dog Probable palmitoyltransferase ZDHHC5, ZDHHC5 ELISA Kit

Sign In for Pricing
View Details
HHAT Human Gene Knockout Kit (CRISPR)
KN208447RB 1 Kit

HHAT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details