Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Somatostatin receptor type 3 (Sstr3)

This Recombinant Rat Somatostatin receptor type 3 (Sstr3) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Somatostatin receptor type 3, SS-3-R, SS3-R, SS3R, SSR-28

UniProt

P30936

Expression Region

1-428

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGL LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVV VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRVRSQEPGSGPPEKTEEE EDEEEEERREEEERRMQRGQEMNGRLSQIAQPGPSGQQQRPCTGTAKEQQLLPQEATAGD KASTLSHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2 (Murine Double Minute-2, HDMX, MGC5370, MGC71221, HDM2) (AP)
MBS6426364-01 0.1 mL

MDM2 (Murine Double Minute-2, HDMX, MGC5370, MGC71221, HDM2) (AP)

Sign In for Pricing
View Details
MDM2 (Murine Double Minute-2, HDMX, MGC5370, MGC71221, HDM2) (AP)
MBS6426364-02 5x 0.1 mL

MDM2 (Murine Double Minute-2, HDMX, MGC5370, MGC71221, HDM2) (AP)

Sign In for Pricing
View Details
ER81 (ETV1) (NM_001163147) Human Tagged ORF Clone Lentiviral Particle
RC228369L4V 200 µL

ER81 (ETV1) (NM_001163147) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
UHMK1 Protein Lysate (Rat) with C-HA Tag
49151036 100 µg

UHMK1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit Monoclonal Rad21 Antibody (9H0H6)
NBP3-15892-100ul 100 µL

Rabbit Monoclonal Rad21 Antibody (9H0H6)

Sign In for Pricing
View Details
B33-20-423 Pre-sized Labels for Printers
152997 350 Roll (350 Label (s) x 1 Box)

B33-20-423 Pre-sized Labels for Printers

Sign In for Pricing
View Details