Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Meleagris gallopavo Beta-4C adrenergic receptor (ADRB4C)

This Recombinant Meleagris gallopavo Beta-4C adrenergic receptor (ADRB4C) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Beta-4C adrenergic receptor, Beta-4C adrenoreceptor, Beta-4C adrenoceptor

UniProt

P43141

Expression Region

1-428

Origin

Meleagris gallopavo (Common turkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPLPAGNGSVPNCSWAAVLSRQWAVGAALSITILVIVAGNLLVIVAIAKTPRLQTMTNV FVTSLACADLVMGLLVVPPGATILLSGHWPYGTVVCELWTSLDVLCVTASIETLCAIAVD RYLAITAPLQYEALVTKGRAWAVVCMVWAISAFISFLPIMNHWWRDGADEQAVRCYDDPR CCDFVTNMTYAIVSSTVSFYVPLLVMIFVYVRVFAVATRHVQLIGKDKVRFLQENPSLSS RGGRWRRPSRLLAIKEHKALKTLGIIMGTFTLCWLPFFVANIIKVFCRPLVPDQLFLFLN WLGYVNSAFNPIIYCRSPDFRSAFRKLLCCPRRADRRLHAAPQDPQHCSCAFSPRGDPME DSKAVDPGHLREDSEVQGSGRREENASSHGGGHQQRPLGECWLQGMQSMLCEQLDEFTST EMPAGPSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-100 1x 100 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details