Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vasoactive intestinal polypeptide receptor 1 (Vipr1)

This Recombinant Mouse Vasoactive intestinal polypeptide receptor 1 (Vipr1) spans the amino acid sequence from region 31-459.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 1, VIP-R-1, Pituitary adenylate cyclase-activating polypeptide type II receptor, PACAP type II receptor, PACAP-R

UniProt

P97751

Expression Region

31-459

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASPHQECEYLQMIEKQRQQCLEEAQLENETTGCSKMWDNLTCWPTTPWGQVVVLDCPLIF QLFSPIHGYNISRNCTEEGWSQLEPGPYHIACGLNDRASSMDEQQQTEFYDAVKTGYTIG YSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNNGETDHCS EASVSCKAAVVFFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYILIGWGVPSVF IMIWTIVRIHFEDFGCWDTIINSSLWWIIKGPILISILVNFILFICIIRILVQKLRPPDI GKNDSSPYSRLAKSTLLLIPLFGVHYVMFAFFPDNFKAQVKMVFELVVGSFQGFVVAILY CFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGVSCSTQVSMLTRVSPSARRSS SFQAEVSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CapG Antibody (1D10) [mFluor Violet 450 SE]
NBP2-59450MFV450 0.1 mL

Mouse Monoclonal CapG Antibody (1D10) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Gadd45gip1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
21177116 3x 1.0 µg

Gadd45gip1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
4-Nonyl Phenol Monoethoxylate-d4
sc-477419 1 mg

4-Nonyl Phenol Monoethoxylate-d4

Sign In for Pricing
View Details
ATRIP Mouse Monoclonal Antibody [Clone ID: OTI5E7]
TA504641 100 µL

ATRIP Mouse Monoclonal Antibody [Clone ID: OTI5E7]

Sign In for Pricing
View Details
C10orf28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
13639062 1.0 µg DNA

C10orf28 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HSPA1A siRNA (Human)
orb1866000-01 15 nmol

HSPA1A siRNA (Human)

Sign In for Pricing
View Details