Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Vasoactive intestinal polypeptide receptor 1 (Vipr1)

This Recombinant Mouse Vasoactive intestinal polypeptide receptor 1 (Vipr1) spans the amino acid sequence from region 31-459.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 1, VIP-R-1, Pituitary adenylate cyclase-activating polypeptide type II receptor, PACAP type II receptor, PACAP-R

UniProt

P97751

Expression Region

31-459

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASPHQECEYLQMIEKQRQQCLEEAQLENETTGCSKMWDNLTCWPTTPWGQVVVLDCPLIF QLFSPIHGYNISRNCTEEGWSQLEPGPYHIACGLNDRASSMDEQQQTEFYDAVKTGYTIG YSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNNGETDHCS EASVSCKAAVVFFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYILIGWGVPSVF IMIWTIVRIHFEDFGCWDTIINSSLWWIIKGPILISILVNFILFICIIRILVQKLRPPDI GKNDSSPYSRLAKSTLLLIPLFGVHYVMFAFFPDNFKAQVKMVFELVVGSFQGFVVAILY CFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGVSCSTQVSMLTRVSPSARRSS SFQAEVSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin expression factor 2 Polyclonal Antibody
MBS9415689-01 0.1 mg

Myelin expression factor 2 Polyclonal Antibody

Sign In for Pricing
View Details
Myelin expression factor 2 Polyclonal Antibody
MBS9415689-02 5x 0.1 mg

Myelin expression factor 2 Polyclonal Antibody

Sign In for Pricing
View Details
Agr2, 21-175aa, Mouse, His-tag, E Coli
MBS206531-01 0.02 mg

Agr2, 21-175aa, Mouse, His-tag, E Coli

Sign In for Pricing
View Details
Agr2, 21-175aa, Mouse, His-tag, E Coli
MBS206531-02 0.1 mg

Agr2, 21-175aa, Mouse, His-tag, E Coli

Sign In for Pricing
View Details
Agr2, 21-175aa, Mouse, His-tag, E Coli
MBS206531-03 5x 0.02 mg

Agr2, 21-175aa, Mouse, His-tag, E Coli

Sign In for Pricing
View Details
Agr2, 21-175aa, Mouse, His-tag, E Coli
MBS206531-04 0.5 mg

Agr2, 21-175aa, Mouse, His-tag, E Coli

Sign In for Pricing
View Details