Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vasoactive intestinal polypeptide receptor 1 (Vipr1)

This Recombinant Rat Vasoactive intestinal polypeptide receptor 1 (Vipr1) spans the amino acid sequence from region 31-459.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 1, VIP-R-1, Pituitary adenylate cyclase-activating polypeptide type II receptor, PACAP type II receptor, PACAP-R

UniProt

P30083

Expression Region

31-459

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASPQHECEYLQLIEIQRQQCLEEAQLENETTGCSKMWDNLTCWPTTPRGQAVVLDCPLIF QLFAPIHGYNISRSCTEEGWSQLEPGPYHIACGLNDRASSLDEQQQTKFYNTVKTGYTIG YSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNSGEIDHCS EASVGCKAAVVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSVF ITIWTVVRIYFEDFGCWDTIINSSLWWIIKAPILLSILVNFVLFICIIRILVQKLRPPDI GKNDSSPYSRLAKSTLLLIPLFGIHYVMFAFFPDNFKAQVKMVFELVVGSFQGFVVAILY CFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGATCSTQVSMLTRVSPSARRSS SFQAEVSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd17c Mouse Gene Knockout Kit (CRISPR)
KN500658 1 Kit

Abhd17c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PARK7 Human Gene Knockout Kit (CRISPR)
KN201645 1 Kit

PARK7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc6a6 Mouse Gene Knockout Kit (CRISPR)
KN516182 1 Kit

Slc6a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Rat VWF (Von Willebrand Factor) ELISA Kit
E-UNEL-R0050-01 5x 96 Tests

Uncoated Rat VWF (Von Willebrand Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat VWF (Von Willebrand Factor) ELISA Kit
E-UNEL-R0050-02 15x 96 Tests

Uncoated Rat VWF (Von Willebrand Factor) ELISA Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-, 1mL 20nm
GP-2101-20 1 mL

Colloidal Gold Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-, 1mL 20nm

Sign In for Pricing
View Details