Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vasoactive intestinal polypeptide receptor 1 (Vipr1)

This Recombinant Rat Vasoactive intestinal polypeptide receptor 1 (Vipr1) spans the amino acid sequence from region 31-459.

Product Specifications

Product Name Alternative

Vasoactive intestinal polypeptide receptor 1, VIP-R-1, Pituitary adenylate cyclase-activating polypeptide type II receptor, PACAP type II receptor, PACAP-R

UniProt

P30083

Expression Region

31-459

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASPQHECEYLQLIEIQRQQCLEEAQLENETTGCSKMWDNLTCWPTTPRGQAVVLDCPLIF QLFAPIHGYNISRSCTEEGWSQLEPGPYHIACGLNDRASSLDEQQQTKFYNTVKTGYTIG YSLSLASLLVAMAILSLFRKLHCTRNYIHMHLFMSFILRATAVFIKDMALFNSGEIDHCS EASVGCKAAVVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYFWGYILIGWGVPSVF ITIWTVVRIYFEDFGCWDTIINSSLWWIIKAPILLSILVNFVLFICIIRILVQKLRPPDI GKNDSSPYSRLAKSTLLLIPLFGIHYVMFAFFPDNFKAQVKMVFELVVGSFQGFVVAILY CFLNGEVQAELRRKWRRWHLQGVLGWSSKSQHPWGGSNGATCSTQVSMLTRVSPSARRSS SFQAEVSLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyoD1 (5.8A), CF647 conjugate, 0.1mg/mL
BNC470191-100 1x 100 µL

MyoD1 (5.8A), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (HepPar1), CF647 conjugate, 0.1mg/mL
BNC470966-500 1x 500 µL

Hepatocyte Specific (HepPar1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF640R conjugate, 0.1mg/mL
BNC403102-500 1x 500 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF405S conjugate, 0.1mg/mL
BNC043131-100 1x 100 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF740 conjugate, 0.1mg/mL
BNC742062-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), Biotin conjugate, 0.1mg/mL
BNCB0167-500 1x 500 µL

GFAP (GA-5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details