Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide FF receptor 1 (NPFFR1)

This Recombinant Human Neuropeptide FF receptor 1 (NPFFR1) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

Neuropeptide FF receptor 1, G-protein coupled receptor 147, RFamide-related peptide receptor OT7T022

UniProt

Q9GZQ6

Expression Region

1-430

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH LPLTIPAWDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mordant Yellow 10 (Technical Grade)
TRC-M635000-1G 1 g

Mordant Yellow 10 (Technical Grade)

Sign In for Pricing
View Details
TIMM8A Mouse Monoclonal Antibody [Clone ID: OTI5C8]
CF809738 100 µg

TIMM8A Mouse Monoclonal Antibody [Clone ID: OTI5C8]

Sign In for Pricing
View Details
Smim19 (NM_001012667) Mouse Tagged ORF Clone
MG200305 10 µg

Smim19 (NM_001012667) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TentaGel® HL PHB
HL12013.1G 1 g

TentaGel® HL PHB

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), Biotin conjugate, 0.1mg/mL
BNCB1577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS706880 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details