Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative chemosensory receptor 43b (Gr43b)

This Recombinant Drosophila melanogaster Putative chemosensory receptor 43b (Gr43b) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

Putative chemosensory receptor 43b

UniProt

Q9V4Q0

Expression Region

1-430

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTGSHSPEAMWSATNFRRHQRKPNQVLHRWFFKGSAWIIYAIACGLHFFKLHYNERTNQ VEESQYHRIWSKIVVVLKVILLASPYLQYFVLGLGIYIHITLVQDSKAQNFLMSLIVLGI VIGVLRRLLIFLHLKRDRRFLKHTVNEILHITSALEQKFGMEYKCDSTLLVVYLAKLWIL TVMLDSLWYKPYFLSSIFLYWVLLEYCFAGYFIYQLILLSWYHTIILFLQRFIEDHANRL DIELHYHRRLIPLFELHLRINNLHKHVRDNVSWLSTSVYLMIFTCIFNAELLIECSLFAG DELENKIYIITDGCLGPVCVPILYVLILGMCTDRFRDAEVQLQQLFVIVQGLYMRKVRPH LLIAMVLENEHTSLIIHQKLKPLENMIILDITCDREFVMDYIVTVILTALSLVQYTISTG GNISECVTHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL
BNC740812-500 1x 500 µL

Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (139H2), CF647 conjugate, 0.1mg/mL
BNC470925-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details