Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2)

This Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2) spans the amino acid sequence from region 1-431.

Product Specifications

Product Name Alternative

Pheromone alpha factor receptor

UniProt

D6VTK4

Expression Region

1-431

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCG AAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFI SRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFKRIGLMLTSISFTLGIATVTM YFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAAN NASKTNTITSDFTTSTDRFYPGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHS ERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYKEGEVEPVDMYTPDTAADEEA RKFWTEDNNNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MCEE sgRNA gene knockout kit - Lentiviral human MCEE sgRNA gene knockout kit (plasmid)
GTR15359708 1 Vial

Lentiviral human MCEE sgRNA gene knockout kit - Lentiviral human MCEE sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Pack of 100 Folded Technical Creped Filter 160G/M², 400 Mm
FT101P0400C Pack of 100

Pack of 100 Folded Technical Creped Filter 160G/M², 400 Mm

Sign In for Pricing
View Details
9130019O22Rik CRISPR/Cas9 KO Plasmid (m)
sc-429748 20 µg

9130019O22Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712677 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Nppb-set siRNA/shRNA/RNAi Lentivector (Rat)
32095096 4x 500 ng

Nppb-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
RPL28P1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1954603 1.0 µg DNA

RPL28P1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details