Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2)

This Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2) spans the amino acid sequence from region 1-431.

Product Specifications

Product Name Alternative

Pheromone alpha factor receptor

UniProt

D6VTK4

Expression Region

1-431

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCG AAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFI SRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFKRIGLMLTSISFTLGIATVTM YFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAAN NASKTNTITSDFTTSTDRFYPGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHS ERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYKEGEVEPVDMYTPDTAADEEA RKFWTEDNNNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR4 Antibody
GWB-MV508D 50 µg

TLR4 Antibody

Sign In for Pricing
View Details
Rabbit S100A16 Antibody
orb1520677-01 10 µL

Rabbit S100A16 Antibody

Sign In for Pricing
View Details
Rabbit S100A16 Antibody
orb1520677-02 100 µL

Rabbit S100A16 Antibody

Sign In for Pricing
View Details
Fascin 1 (55K-2) Alexa Fluor® 680
sc-21743 AF680 200 µg/mL

Fascin 1 (55K-2) Alexa Fluor® 680

Sign In for Pricing
View Details
Recombinant Human ZNF641 protein, His-tagged
ZNF641-2488H 25 µg

Recombinant Human ZNF641 protein, His-tagged

Sign In for Pricing
View Details
DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 750) discontinued
126023-ML750 100 µL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 750) discontinued

Sign In for Pricing
View Details