Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2)

This Recombinant Saccharomyces cerevisiae Pheromone alpha factor receptor (STE2) spans the amino acid sequence from region 1-431.

Product Specifications

Product Name Alternative

Pheromone alpha factor receptor

UniProt

P0CI39

Expression Region

1-431

Origin

Saccharomyces cerevisiae (Baker's yeast)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDAAPSLSNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVRCG AAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSSVTYALTGFPQFI SRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDNFKRIGLMLTSISFTLGIATVTM YFVSAVKGMIVTYNDVSATQDKYFNASTILLASSINFMSFVLVVKLILAIRSRRFLGLKQ FDSFHILLIMSCQSLLVPSIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAAN NASKTNTITSDFTTSTDRFYPGTLSSFQTDSINNDAKSSLRSRLYDLYPRRKETTSDKHS ERTFVSETADDIEKNQFYQLPTPTSSKNTRIGPFADASYKEGEVEPVDMYTPDTAADEEA RKFWTEDNNNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS22 Rabbit Polyclonal Antibody
AP21073PU-N 100 µg

MRPS22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human TIGIT Protein (His & Avi Tag)
PKSH033793-01 20 µg

Recombinant Human TIGIT Protein (His & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human TIGIT Protein (His & Avi Tag)
PKSH033793-02 100 µg

Recombinant Human TIGIT Protein (His & Avi Tag)

Sign In for Pricing
View Details
GRINA (Center) Rabbit Polyclonal Antibody
AP51957PU-N 400 µL

GRINA (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS503467 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Rat C3a (Complement Component 3a) ELISA Kit
E-EL-R0255-01 24 Tests

Rat C3a (Complement Component 3a) ELISA Kit

Sign In for Pricing
View Details