Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 22 (GPR22)

This Recombinant Human Probable G-protein coupled receptor 22 (GPR22) spans the amino acid sequence from region 1-433.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 22

UniProt

Q99680

Expression Region

1-433

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCFSPILEINMQSESNITVRDDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNL TVLVLYCMKSNLINSVSNIITMNLHVLDVIICVGCIPLTIVILLLSLESNTALICCFHEA CVSFASVSTAINVFAITLDRYDISVKPANRILTMGRAVMLMISIWIFSFFSFLIPFIEVN FFSLQSGNTWENKTLLCVSTNEYYTELGMYYHLLVQIPIFFFTVVVMLITYTKILQALNI RIGTRFSTGQKKKARKKKTISLTTQHEATDMSQSSGGRNVVFGVRTSVSVIIALRRAVKR HRERRERQKRVFRMSLLIISTFLLCWTPISVLNTTILCLGPSDLLVKLRLCFLVMAYGTT IFHPLLYAFTRQKFQKVLKSKMKKRVVSIVEADPLPNNAVIHNSWIDPKRNKKITFEDSE IREKCLVPQVVTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS704425 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Phospholipase A2 (PLB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]
TA506860AM 100 µL

Phospholipase A2 (PLB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), 0.2mg/mL
BNUB1505-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), 0.2mg/mL

Sign In for Pricing
View Details
ATG4B Antibody: FITC
SPC-630D-FITC 100 µg

ATG4B Antibody: FITC

Sign In for Pricing
View Details
DM1 Mouse Monoclonal Antibody [A4G3]
HA600014 100 µL

DM1 Mouse Monoclonal Antibody [A4G3]

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD565286 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details