Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Pyroglutamylated RFamide peptide receptor (Qrfpr)

This Recombinant Rat Pyroglutamylated RFamide peptide receptor (Qrfpr) spans the amino acid sequence from region 1-433.

Product Specifications

Product Name Alternative

Pyroglutamylated RFamide peptide receptor, AQ27, G-protein coupled receptor 103, Orexigenic neuropeptide QRFP receptor, SP9155

UniProt

P83858

Expression Region

1-433

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKVAFALAGALIFALAL FGNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKM VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPM WHVQRLEIKYDFLYEKEHICCLEEWASPVHQRIYSTFILVILFLLPLVVMLVLYSKIGYE LWIKKRVGDSSALQTIHGKEMSKIARKKKRAVIMMVTVVALFAACWAPFHVVHMMVEYSN FEKEYDDVTIKMVFAVAQTIGFFNSICNPFVYAFMNENFKKNFLSAVCYCIVKESSSPAR KPGNSGISMMQKRAKLSRPQRPVEETKGDTFSDASIDVKLCEQPREKRQLKRQLAFFSSE LSENSTFGSGHEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHD4 Rabbit Polyclonal Antibody (FITC)
orb2135155 100 µL

CHD4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HIP1 Antibody
KC-1615-01 50 μL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-1615-02 100 µL

HIP1 Antibody

Sign In for Pricing
View Details
HIP1 Antibody
KC-1615-03 1 mL

HIP1 Antibody

Sign In for Pricing
View Details
Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (MaxLight 490)
MBS6402875-01 0.1 mL

Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (MaxLight 490)

Sign In for Pricing
View Details
Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (MaxLight 490)
MBS6402875-02 5x 0.1 mL

Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (MaxLight 490)

Sign In for Pricing
View Details