Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Alpha-2 adrenergic receptor

This Recombinant Carassius auratus Alpha-2 adrenergic receptor spans the amino acid sequence from region 1-436.

Product Specifications

Product Name Alternative

Alpha-2 adrenergic receptor, Alpha-2 adrenoreceptor, Alpha-2 adrenoceptor

UniProt

P32251

Expression Region

1-436

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVTQSNATKDDANITVTPWPYTETAAAFIILVVSVIILVSIVGNVLVIVAVLTSRALRA PQNLFLVSLACADILVATLVIPFSLANEIMGYWFFGSTWCAFYLALDVLFCTSSIVHLCA ISLDRYWSVTKAVSYNLKRTPKRIKSMIAVVWVISAVISFPPLIMTKHDEKECLINDETW YILSSSLVSFFAPGFIMITVYCKIYRVAKQRSSTVFVAKNGLERQPSQSETCFVRKDKFE KESPSSNSSESNQRQEELDDIDLEESATSDNKPKSSRFSNRRRVDGARCCPQRTCRISWV SSQEQSSKQLAVASKTKVAQMREKRFTFVLTVVMGVFVLCWFPFFFTYSLHAICGDSCEP PEALFKLFFWIGYCNSSVNPIIYTIFNRDFRKAFKKICLLDCAAHLRDSCLGTLGRLNAK CIFECHQKSNQEETAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF405S conjugate, 0.1mg/mL
BNC041573-100 1x 100 µL

N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF640R conjugate, 0.1mg/mL
BNC402324-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (IM260), CF568 conjugate, 0.1mg/mL
BNC680260-100 1x 100 µL

IgM Immunoglobulin (IM260), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF488A conjugate, 0.1mg/mL
BNC880396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details