Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr)

This Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr) spans the amino acid sequence from region 19-455.

Product Specifications

Product Name Alternative

Gastric inhibitory polypeptide receptor, GIP-R, Glucose-dependent insulinotropic polypeptide receptor

UniProt

P43219

Expression Region

19-455

Origin

Rattus norvegicus (Rat)

Field of Research

Gastroenterology & Hepatology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTAR VSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQVVY TVGYSLSLATLLLALLILSLFRRLHCTRNYIHMNLFTSFMLRAGAILTRDQLLPPLGPYT GNQTPTLWNQALAACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCYLL LGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILITILINFLIFIRILGIL VSKLRTRQMRCPDYRLRLARSTLTLMPLLGVHEVVFAPVTEEQAEGSLRFAKLAFEIFLS SFQGFLVSVLYCFINKEVQSEIRRLRLSLQEQCPRPHLGQAPRAVPLSSAPQEAAIRNAL PSGMLHVPGDEVLESYC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF405S conjugate, 0.1mg/mL
BNC042397-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CALP), CF640R conjugate, 0.1mg/mL
BNC400831-500 1x 500 µL

Calponin-1 (CALP), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (BP53-12 + DO-7), CF740 conjugate, 0.1mg/mL
BNC740723-500 1x 500 µL

P53 (BP53-12 + DO-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF640R conjugate, 0.1mg/mL
BNC401176-500 1x 500 µL

EMI1 (EMI1/1176), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF680R conjugate, 0.1mg/mL
BNC810010-500 1x 500 µL

MART-1 / Melan-A (M2-9E3), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details