Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes 5-hydroxytryptamine receptor 6 (HTR6)

This Recombinant Pan troglodytes 5-hydroxytryptamine receptor 6 (HTR6) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 6, 5-HT-6, 5-HT6, Serotonin receptor 6

UniProt

Q5IS65

Expression Region

1-440

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEPGPSANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPPRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATRDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 488 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
MFluor™ Green 620 acid
1144-AAT 5 mg

MFluor™ Green 620 acid

Sign In for Pricing
View Details
Polystyrene AM RAM
H12516023.25G 25 g

Polystyrene AM RAM

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B12]
TA807310AM 100 µL

MALT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B12]

Sign In for Pricing
View Details