Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6)

This Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 6, 5-HT-6, 5-HT6, Serotonin receptor 6

UniProt

Q9R1C8

Expression Region

1-440

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF FVTDSVEPEIRQHPLGSPMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997S-01 50 Tests

Elab Fluor® Red 780 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997S-02 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997S-03 2x 100 Tests

Elab Fluor® Red 780 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
CD137, Mouse (LOB12), CF568 conjugate, 0.1mg/mL
BNC682012-100 1x 100 µL

CD137, Mouse (LOB12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse TF Antibody Pair Set
E-KAB-0576 50 µL & 100 µg

Mouse TF Antibody Pair Set

Sign In for Pricing
View Details
OR5U1 Antibody
8G655-AAT 50 µg

OR5U1 Antibody

Sign In for Pricing
View Details