Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6)

This Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 6, 5-HT-6, 5-HT6, Serotonin receptor 6

UniProt

Q9R1C8

Expression Region

1-440

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF FVTDSVEPEIRQHPLGSPMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A10]
TA503104BM 100 µL

CDK2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse IgM Antibody[RMM-1]
E-AB-F1190UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse IgM Antibody[RMM-1]

Sign In for Pricing
View Details
Chromogranin A (CHGA/777), 1mg/mL
BNUM0777-50 1x 50 µL

Chromogranin A (CHGA/777), 1mg/mL

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (MB/2105), CF647 conjugate, 0.1mg/mL
BNC472105-500 1x 500 µL

Myoglobin (Muscle Cell Marker) (MB/2105), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ProPette™ LE Starter Kit
P5200-SK 1 Each

ProPette™ LE Starter Kit

Sign In for Pricing
View Details