Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Apolipoprotein N-acyltransferase (lnt)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Apolipoprotein N-acyltransferase (lnt) spans the amino acid sequence from region 1-441.

Product Specifications

Product Name Alternative

Apolipoprotein N-acyltransferase, ALP N-acyltransferase, EC= 2.3.1.-

UniProt

Q9PNJ9

Expression Region

1-441

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLKLNFLPYFSFIPKKLNTNSIIFKIIKVFFIAILLSNSIYLSFFENIFTQTISPFLAI WGLVLLLKSKTSKQYFWIGFFVGILWFWWIGLSSIYFNLNYLVPIIPIIIGFIYGLLFRL CYLLKFDFLRLCGIFCISFIHPLGFDWFNWGIFTVYGFFDPSYRGIICIFLIAYFIYEGY ISRYYKIAIVLILFFSGFQYNEKQAQTLNLNYKLINTNISQDQKFLQENLKSNSDILIQD ILQAINEKKELVILPETAFAFDLKNTKYELMLKELSYKITIITGAFHVEKEHTYNSTYIF KKGNVYILNKHFLVPFGEEIPFFKDLTKKYFLKNIEEFSKGPIQSKYKLDNQIITNAICY EATKEQNYQNSQIIIALSNNAWFNNSSEYKLQQLLMKFYASKYGVSVYHATNGKENIVIL PKKLLSKDWKNLSKEIFNDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-100 1x 100 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
BNC470009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (BA17), CF568 conjugate, 0.1mg/mL
BNC680666-500 1x 500 µL

Cytokeratin 19 (BA17), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details