Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Apolipoprotein N-acyltransferase (lnt)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Apolipoprotein N-acyltransferase (lnt) spans the amino acid sequence from region 1-441.

Product Specifications

Product Name Alternative

Apolipoprotein N-acyltransferase, ALP N-acyltransferase, EC= 2.3.1.-

UniProt

Q9PNJ9

Expression Region

1-441

Origin

Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLKLNFLPYFSFIPKKLNTNSIIFKIIKVFFIAILLSNSIYLSFFENIFTQTISPFLAI WGLVLLLKSKTSKQYFWIGFFVGILWFWWIGLSSIYFNLNYLVPIIPIIIGFIYGLLFRL CYLLKFDFLRLCGIFCISFIHPLGFDWFNWGIFTVYGFFDPSYRGIICIFLIAYFIYEGY ISRYYKIAIVLILFFSGFQYNEKQAQTLNLNYKLINTNISQDQKFLQENLKSNSDILIQD ILQAINEKKELVILPETAFAFDLKNTKYELMLKELSYKITIITGAFHVEKEHTYNSTYIF KKGNVYILNKHFLVPFGEEIPFFKDLTKKYFLKNIEEFSKGPIQSKYKLDNQIITNAICY EATKEQNYQNSQIIIALSNNAWFNNSSEYKLQQLLMKFYASKYGVSVYHATNGKENIVIL PKKLLSKDWKNLSKEIFNDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACCSL siRNA Oligos set (Human)
11164171 3x 5 nmol

ACCSL siRNA Oligos set (Human)

Sign In for Pricing
View Details
KRT8P16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1167405 3x 1.0 µg

KRT8P16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Gm4838 3'UTR Luciferase Stable Cell Line
TU108110 1.0 mL

Gm4838 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Vmn1r213 3'UTR Luciferase Stable Cell Line
TU121879 1.0 mL

Vmn1r213 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KCND3 Rabbit Polyclonal Antibody (Biotin)
orb2133848 100 µL

KCND3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
AmMag™ Wand D12
L00778 1 PC

AmMag™ Wand D12

Sign In for Pricing
View Details