Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein B (crlB)

This Recombinant Dictyostelium discoideum Cyclic AMP receptor-like protein B (crlB) spans the amino acid sequence from region 1-442.

Product Specifications

Product Name Alternative

Cyclic AMP receptor-like protein B

UniProt

Q6UUW5

Expression Region

1-442

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGDIHLCSMILGKNHLIFLYFANLFGSTLSFLATIITIVFYLVKKYIQNKSFRENPHQY CHQHQYFDSSKLNEINNSGVGSYSSTPISIQNNNNKNNNLPKQKNNEKQPLINKNHNNYC NYSTSATSSSSSSSSFSSTNSGSSYEYQQPQKNQQTLSSSDKNNTIPSTNTKYEIELSIP QFKGNKCGPNCLLFSNIPQIKNALEQKKNPKKIDTLIFYLSISDFIAVSGIIIEQLIIIF NKEISKSIGFCIGERVSIHFGLLATLFWSNCIAYYLLRETYELKPYNIRFVYFHIVCWGM ALIGVASLFFSKIITVSNIDQGGSWCSVSSSYQLYFWVIPLFVSFTWNLICYCLIYRKFN KIIGIYGIQSVQIKTIIIRKLSFYLLAFLITWVWDVINNSIFLYEGKCPPFALWILQEFF SSGYGFFNSLAYAVTTRFYSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF568 conjugate, 0.1mg/mL
BNC681553-500 1x 500 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF568 conjugate, 0.1mg/mL
BNC682886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details