Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative EGF-like module-containing mucin-like hormone receptor-like 4 (EMR4P)

This Recombinant Human Putative EGF-like module-containing mucin-like hormone receptor-like 4 (EMR4P) spans the amino acid sequence from region 15-457.

Product Specifications

Product Name Alternative

Putative EGF-like module-containing mucin-like hormone receptor-like 4, EGF-like module receptor 4, G-protein coupled receptor 127, G-protein coupled receptor PGR16

UniProt

Q86SQ3

Expression Region

15-457

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNK VGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGD KRTKHICVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVIT QVGLTISLLCLFLAILTFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCS IIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIA VSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIILINLVFYFQVLWILRSKLSSLNKEV STIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSFTIINTLQGVLLFVV HCLLNRQVRLIILSVISLVPKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD33 (C33/69), CF647 conjugate, 0.1mg/mL
BNC470069-500 1x 500 µL

CD33 (C33/69), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991), CF568 conjugate, 0.1mg/mL
BNC680991-500 1x 500 µL

SOX10 (SOX10/991), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF740 conjugate, 0.1mg/mL
BNC740923-500 1x 500 µL

Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/796), CF488A conjugate, 0.1mg/mL
BNC880796-100 1x 100 µL

Bcl-2 (BCL2/796), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details