Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative EGF-like module-containing mucin-like hormone receptor-like 4 (EMR4P)

This Recombinant Human Putative EGF-like module-containing mucin-like hormone receptor-like 4 (EMR4P) spans the amino acid sequence from region 15-457.

Product Specifications

Product Name Alternative

Putative EGF-like module-containing mucin-like hormone receptor-like 4, EGF-like module receptor 4, G-protein coupled receptor 127, G-protein coupled receptor PGR16

UniProt

Q86SQ3

Expression Region

15-457

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNK VGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGD KRTKHICVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVIT QVGLTISLLCLFLAILTFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCS IIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIA VSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIILINLVFYFQVLWILRSKLSSLNKEV STIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSFTIINTLQGVLLFVV HCLLNRQVRLIILSVISLVPKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pitpnc1 ORF Vector (Mouse) (pORF)
36847014 1.0 µg DNA

Pitpnc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lentiviral mouse Plekhf2 shRNA (UAS) - Lentiviral mouse Plekhf2 shRNA (UAS) (100)
GTR15296913 1 Vial

Lentiviral mouse Plekhf2 shRNA (UAS) - Lentiviral mouse Plekhf2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Nas-17 Antibody
orb801120 2 mg

Nas-17 Antibody

Sign In for Pricing
View Details
Goal anti-Cat IgA Heavy Chain Antibody FITC Conjugated
A20-101F 1 mg

Goal anti-Cat IgA Heavy Chain Antibody FITC Conjugated

Sign In for Pricing
View Details
Mouse Protein FAM76B, Fam76b ELISA KIT
ELI-09483m 96 Tests

Mouse Protein FAM76B, Fam76b ELISA KIT

Sign In for Pricing
View Details
C17orf49 Protein Vector (Human) (pPB-His-GST)
PV329299 500 ng

C17orf49 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details