Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog D (2) dopamine receptor (DRD2)

This Recombinant Dog D (2) dopamine receptor (DRD2) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

D (2) dopamine receptor, Dopamine D2 receptor

UniProt

Q9GJU1

Expression Region

1-443

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLESQNWSRPFNGSEGKPGKPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTERSSRAFRANLKAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTADSPAKPEKNGHAKDHPKIAKIFEIQSMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCECNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE3 Rabbit Polyclonal Antibody
TA361750 100 µL

CPNE3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF488 Anti-Mouse CD24 Antibody
RD21974F-01 25 µg

AF488 Anti-Mouse CD24 Antibody

Sign In for Pricing
View Details
AF488 Anti-Mouse CD24 Antibody
RD21974F-02 100 µg

AF488 Anti-Mouse CD24 Antibody

Sign In for Pricing
View Details
Pan PCDHGA Mouse Monoclonal Antibody [Clone ID: N144/32]
75-178 100 µL

Pan PCDHGA Mouse Monoclonal Antibody [Clone ID: N144/32]

Sign In for Pricing
View Details
VEGFA Human Gene Knockout Kit (CRISPR)
KN217312BN 1 Kit

VEGFA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMPRSS2 Human Gene Knockout Kit (CRISPR)
KN208677RB 1 Kit

TMPRSS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details