Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Deinococcus radiodurans C4-dicarboxylate transport protein (dctA)

This Recombinant Deinococcus radiodurans C4-dicarboxylate transport protein (dctA) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

C4-dicarboxylate transport protein

UniProt

Q9RRG7

Expression Region

1-443

Origin

Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKIFRSLYVQVIIAIVLGILVGALFPKFGEALKPLGDIFVKLIKMVIAPIIFATVVSGV AHMRDTRKVGRVGGKALIYFEVVSTLALIIGMVVMNVLRPGAGMNVDPATLDTAGLTKYT EAAGEMTVWDHILKIIPDTLVSAFTGGELLPVLLVALLFGFALMRLGKLGDQILYGIDAL NQVVFVILGFIMRLAPIGAFGAMAFTVGKYGLKSLTSLGYLMGSFYLTCLLFIFVVLGLI ARAAGFSIFKLIRYIREELLIVLGTSSSESALPRLMMKLEHAGAEKSVVGLVVPTGYSFN LDGTSIYLTMAALFIAQATNTPLGLGEQLSLLAVLLLTSKGAAGVTGSGFITLAATLGAV GHVPVAGMALILGIDRFMSEARALTNFIGNAVATLVVARSENAVDMNRLTRALNGEDLPT TEPDVASEERGEGREIDSSRPVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details