Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D (2) dopamine receptor (Drd2)

This Recombinant Mouse D (2) dopamine receptor (Drd2) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

D (2) dopamine receptor, Dopamine D2 receptor

UniProt

P61168

Expression Region

1-444

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FabA Antibody
orb814633 2 mg

FabA Antibody

Sign In for Pricing
View Details
ACTR1A (Alpha-centractin, Centractin, ARP1, Actin-RPV, Centrosome-associated Actin Homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002) (MaxLight 550)
MBS6210072-01 0.1 mL

ACTR1A (Alpha-centractin, Centractin, ARP1, Actin-RPV, Centrosome-associated Actin Homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002) (MaxLight 550)

Sign In for Pricing
View Details
ACTR1A (Alpha-centractin, Centractin, ARP1, Actin-RPV, Centrosome-associated Actin Homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002) (MaxLight 550)
MBS6210072-02 5x 0.1 mL

ACTR1A (Alpha-centractin, Centractin, ARP1, Actin-RPV, Centrosome-associated Actin Homolog, CTRN1, FLJ52695, FLJ52800, FLJ55002) (MaxLight 550)

Sign In for Pricing
View Details
Anti-CRB1 Antibody Picoband®, Cy3 Conjugate
A01499-1-Cy3 100 µg/Vial

Anti-CRB1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (MaxLight 490)
MBS6253577-01 0.1 mL

CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (MaxLight 490)

Sign In for Pricing
View Details
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (MaxLight 490)
MBS6253577-02 5x 0.1 mL

CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (MaxLight 490)

Sign In for Pricing
View Details