Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D (2) dopamine receptor (Drd2)

This Recombinant Mouse D (2) dopamine receptor (Drd2) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

D (2) dopamine receptor, Dopamine D2 receptor

UniProt

P61168

Expression Region

1-444

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSEGKPDRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF416, CT (ZNF416, Zinc finger protein 416) (MaxLight 750)
MBS6366534-01 0.1 mL

ZNF416, CT (ZNF416, Zinc finger protein 416) (MaxLight 750)

Sign In for Pricing
View Details
ZNF416, CT (ZNF416, Zinc finger protein 416) (MaxLight 750)
MBS6366534-02 5x 0.1 mL

ZNF416, CT (ZNF416, Zinc finger protein 416) (MaxLight 750)

Sign In for Pricing
View Details
FSCN1 antibody
70R-17358 50 μL

FSCN1 antibody

Sign In for Pricing
View Details
Heparan sulfate glucosamine 3-O-sulfotransferase 5 (HS3ST5) Mouse ELISA Kit
D9843 96 Tests

Heparan sulfate glucosamine 3-O-sulfotransferase 5 (HS3ST5) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human Cdc25B (phospho Ser353) Polyclonal Antibody
PA91274HU-01 50 µg

Rabbit Anti-Human Cdc25B (phospho Ser353) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Cdc25B (phospho Ser353) Polyclonal Antibody
PA91274HU-02 100 µg

Rabbit Anti-Human Cdc25B (phospho Ser353) Polyclonal Antibody

Sign In for Pricing
View Details