Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D (2) dopamine receptor (Drd2)

This Recombinant Rat D (2) dopamine receptor (Drd2) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

D (2) dopamine receptor, Dopamine D2 receptor

UniProt

P61169

Expression Region

1-444

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceacam10 Mouse Gene Knockout Kit (CRISPR)
KN503086 1 Kit

Ceacam10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM131 Human Gene Knockout Kit (CRISPR)
KN420348 1 Kit

TMEM131 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD14 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12C8]
TA811528AM 100 µL

CD14 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12C8]

Sign In for Pricing
View Details
SUC1 Goat Polyclonal Antibody
TA396664S 25 µL

SUC1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Lrrc4 Mouse Monoclonal Antibody [Clone ID: N50/36]
75-084 100 µL

Lrrc4 Mouse Monoclonal Antibody [Clone ID: N50/36]

Sign In for Pricing
View Details
Uncoated Human EGF (Epidermal Growth Factor) ELISA Kit
E-UNEL-H0040-01 5x 96 Tests

Uncoated Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details