Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D (2) dopamine receptor (Drd2)

This Recombinant Rat D (2) dopamine receptor (Drd2) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

D (2) dopamine receptor, Dopamine D2 receptor

UniProt

P61169

Expression Region

1-444

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)
MBS2053001-01 0.1 mL

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)
MBS2053001-02 0.2 mL

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)
MBS2053001-03 0.5 mL

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)
MBS2053001-04 1 mL

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)
MBS2053001-05 5 mL

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)
MBS2053001-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Keratin 20 (KRT20)

Sign In for Pricing
View Details