Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H3 receptor (HRH3)

This Recombinant Human Histamine H3 receptor (HRH3) spans the amino acid sequence from region 1-445.

Product Specifications

Product Name Alternative

Histamine H3 receptor, H3R, HH3R, G-protein coupled receptor 97

UniProt

Q9Y5N1

Expression Region

1-445

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Ly6/PLAUR domain containing protein 6B (LYPD6B) ELISA Kit
GTR10343661 96 Well

Sheep Ly6/PLAUR domain containing protein 6B (LYPD6B) ELISA Kit

Sign In for Pricing
View Details
CTDNEP1 Polyclonal Antibody, FITC Conjugated
A54015-100 100 µL

CTDNEP1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Trim72 (NM_001079932) Mouse Over-expression Lysate
LM00002V 100 µg

Trim72 (NM_001079932) Mouse Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Calreticulin/CALR Protein, C-His
MBS1579402-01 0.1 mg

Recombinant Human Calreticulin/CALR Protein, C-His

Sign In for Pricing
View Details
Recombinant Human Calreticulin/CALR Protein, C-His
MBS1579402-02 1 mg

Recombinant Human Calreticulin/CALR Protein, C-His

Sign In for Pricing
View Details
Recombinant Human Calreticulin/CALR Protein, C-His
MBS1579402-03 5x 1 mg

Recombinant Human Calreticulin/CALR Protein, C-His

Sign In for Pricing
View Details