Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H3 receptor (HRH3)

This Recombinant Human Histamine H3 receptor (HRH3) spans the amino acid sequence from region 1-445.

Product Specifications

Product Name Alternative

Histamine H3 receptor, H3R, HH3R, G-protein coupled receptor 97

UniProt

Q9Y5N1

Expression Region

1-445

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis VHP Ftg 1/16in FngrTt 10pk
CHR5291 1 Each

Kinesis VHP Ftg 1/16in FngrTt 10pk

Sign In for Pricing
View Details
CD1b (RIV12), Biotin conjugate, 0.1mg/mL
BNCB0317-100 1x 100 µL

CD1b (RIV12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lentiviral mouse Bahcc1 shRNA (UAS) - Lentiviral mouse Bahcc1 shRNA (UAS, iRFP) (25)
GTR15185054 1 Vial

Lentiviral mouse Bahcc1 shRNA (UAS) - Lentiviral mouse Bahcc1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human Siglec1 (Sialic Acid Binding Immunoglobulin Like Lectin 1) ELISA Kit
FY-EH2711 96 Well

Human Siglec1 (Sialic Acid Binding Immunoglobulin Like Lectin 1) ELISA Kit

Sign In for Pricing
View Details
Phospho-CD40 (T254) Antibody
MBS7118714-01 0.05 mg

Phospho-CD40 (T254) Antibody

Sign In for Pricing
View Details
Phospho-CD40 (T254) Antibody
MBS7118714-02 0.1 mg

Phospho-CD40 (T254) Antibody

Sign In for Pricing
View Details