Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bombyx mori 5-hydroxytryptamine receptor

This Recombinant Bombyx mori 5-hydroxytryptamine receptor spans the amino acid sequence from region 1-446.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor, 5-HT receptor, Serotonin receptor

UniProt

Q17239

Expression Region

1-446

Origin

Bombyx mori (Silk moth)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGAEGQEELDWEALYLRLPLQNCSWNSTGWEPNWNVTVVPNTTWWQASAPFDTPAALVR AAAKAVVLGLLILATVVGNVFVIAAILLERHLRSAANNLILSLAVADLLVACLVMPLGAV YEVVQRWTLGPELCDMWTSGDVLCCTASILHLVAIALDRYWAVTNIDYIHASTAKRVGMM IACVWTVSFFVCIAQLLGWKDPDWNQRVSEDLRCVVSQDVGYQIFATASSFYVPVLIILI LYWRIYQTARKRIRRRRGATARGGVGPPPVPAGGALVAGGGSGGIAAAVVAVIGRPLPTI SETTTTGFTNVSSNNTSPEKQSCANGLEADPPTTGYGAVAAAYYPSLVRRKPKEAADSKR ERKAAKTLAIITGAFVACWLPFFVLAILVPTCDCEVSPVLTSLSLWLGYFNSTLNPVIYT VFSPEFRHAFQRLLCGRRVRRRRAPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP15 (COP9 signalosome Complex Subunit 2, SGN2, Signalosome Subunit 2, Alien Homolog, JAB1-Containing signalosome Subunit 2, Thyroid Receptor-Interacting Protein 15, TR-Interacting Protein 15, TRIP-15, COPS2, CSN2) discontinued
361366-01 50 µL

TRIP15 (COP9 signalosome Complex Subunit 2, SGN2, Signalosome Subunit 2, Alien Homolog, JAB1-Containing signalosome Subunit 2, Thyroid Receptor-Interacting Protein 15, TR-Interacting Protein 15, TRIP-15, COPS2, CSN2) discontinued

Sign In for Pricing
View Details
TRIP15 (COP9 signalosome Complex Subunit 2, SGN2, Signalosome Subunit 2, Alien Homolog, JAB1-Containing signalosome Subunit 2, Thyroid Receptor-Interacting Protein 15, TR-Interacting Protein 15, TRIP-15, COPS2, CSN2) discontinued
361366-02 100 µL

TRIP15 (COP9 signalosome Complex Subunit 2, SGN2, Signalosome Subunit 2, Alien Homolog, JAB1-Containing signalosome Subunit 2, Thyroid Receptor-Interacting Protein 15, TR-Interacting Protein 15, TRIP-15, COPS2, CSN2) discontinued

Sign In for Pricing
View Details
Mouse Proliferating cell nuclear antigen ELISA Kit
orb1661434 96 Tests

Mouse Proliferating cell nuclear antigen ELISA Kit

Sign In for Pricing
View Details
Human Ornithine Carbamoyl Transferase (OTC) ELISA Kit
abx054142 96 Well

Human Ornithine Carbamoyl Transferase (OTC) ELISA Kit

Sign In for Pricing
View Details
Epiberberine
TBZ2742 20mg

Epiberberine

Sign In for Pricing
View Details
Salmonella sp. (A, B, C1, C2, D, E1 & E2 Groups) (PE) discontinued
S0060-26H-PE 100 µL

Salmonella sp. (A, B, C1, C2, D, E1 & E2 Groups) (PE) discontinued

Sign In for Pricing
View Details