Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine D (1A) dopamine receptor (DRD1)

This Recombinant Bovine D (1A) dopamine receptor (DRD1) spans the amino acid sequence from region 1-446.

Product Specifications

Product Name Alternative

D (1A) dopamine receptor, Dopamine D1 receptor

UniProt

Q95136

Expression Region

1-446

Origin

Bos taurus (Bovine)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLG KTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN CQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET VSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (2-fluorophenyl) thiophene-2-carboxylic acid
sc-352575 250 mg

5- (2-fluorophenyl) thiophene-2-carboxylic acid

Sign In for Pricing
View Details
REG4 Human, Sf9
32-13380-10 10 µg

REG4 Human, Sf9

Sign In for Pricing
View Details
ADD1 (ADDA, Alpha-adducin, Erythrocyte adducin subunit alpha) discontinued
341725-01 100 µL

ADD1 (ADDA, Alpha-adducin, Erythrocyte adducin subunit alpha) discontinued

Sign In for Pricing
View Details
ADD1 (ADDA, Alpha-adducin, Erythrocyte adducin subunit alpha) discontinued
341725-02 200 µL

ADD1 (ADDA, Alpha-adducin, Erythrocyte adducin subunit alpha) discontinued

Sign In for Pricing
View Details
Zfp280c (NM_001166649) Mouse Tagged Lenti ORF Clone
MR223427L3 10 µg

Zfp280c (NM_001166649) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CCS (NM_005125) Human Tagged ORF Clone Lentiviral Particle
RC211311L1V 200 µL

CCS (NM_005125) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details