Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D (3) dopamine receptor (Drd3)

This Recombinant Mouse D (3) dopamine receptor (Drd3) spans the amino acid sequence from region 1-446.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P30728

Expression Region

1-446

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQISSHINSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGELK RYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3226), CF647 conjugate, 0.1mg/mL
BNC473226-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biological Microscope BMIC-702
BMIC-702 1 Unit

Biological Microscope BMIC-702

Sign In for Pricing
View Details
Recombinant Human Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-mFc)
PKSH033925-01 10 µg

Recombinant Human Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-mFc)

Sign In for Pricing
View Details
Recombinant Human Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-mFc)
PKSH033925-02 50 µg

Recombinant Human Leukocyte-associated Immunoglobulin-like Receptor 1/LAIR1/CD305 (C-mFc)

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF594 conjugate, 0.1mg/mL
BNC942400-500 1x 500 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mitochondrial Marker (113-1), CF640R conjugate, 0.1mg/mL
BNC400739-100 1x 100 µL

Mitochondrial Marker (113-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details