Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse D (3) dopamine receptor (Drd3)

This Recombinant Mouse D (3) dopamine receptor (Drd3) spans the amino acid sequence from region 1-446.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P30728

Expression Region

1-446

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQISSHINSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGELK RYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNIEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb43 Recombinant Protein (Rat)
RP197837 100 µg

Defb43 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Phosphatase And Tensin Homolog (PTEN) Magnetic Fluorescence Assay Kit
MBS2160262-01 96 Tests

Phosphatase And Tensin Homolog (PTEN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Phosphatase And Tensin Homolog (PTEN) Magnetic Fluorescence Assay Kit
MBS2160262-02 5x 96 Tests

Phosphatase And Tensin Homolog (PTEN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Phosphatase And Tensin Homolog (PTEN) Magnetic Fluorescence Assay Kit
MBS2160262-03 10x 96 Tests

Phosphatase And Tensin Homolog (PTEN) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
1-[ (5-Sulfanyl-1,3,4-oxadiazol-2-yl) methyl]azepan-2-one
QGB27076-01 250 mg

1-[ (5-Sulfanyl-1,3,4-oxadiazol-2-yl) methyl]azepan-2-one

Sign In for Pricing
View Details
1-[ (5-Sulfanyl-1,3,4-oxadiazol-2-yl) methyl]azepan-2-one
QGB27076-02 2.5 g

1-[ (5-Sulfanyl-1,3,4-oxadiazol-2-yl) methyl]azepan-2-one

Sign In for Pricing
View Details