Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D (1A) dopamine receptor

This Recombinant Rat D (1A) dopamine receptor spans the amino acid sequence from region 1-446.

Product Specifications

Product Name Alternative

D (1A) dopamine receptor, Dopamine D1 receptor

UniProt

P18901

Expression Region

1-446

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL SVILDYDTDVSLEKIQPVTHSGQHST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFAND2B activation kit by CRISPRa
GA115123 1 Kit

Human ZFAND2B activation kit by CRISPRa

Sign In for Pricing
View Details
Golgi Complex (AE-6), CF640R conjugate, 0.1mg/mL
BNC400868-500 1x 500 µL

Golgi Complex (AE-6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNIK Human Gene Knockout Kit (CRISPR)
KN424180 1 Kit

TNIK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF568 conjugate, 0.1mg/mL
BNC681423-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human VWFCP/ADAMTS13 protein (His tag)
PDEH100888-01 20 µg

Recombinant Human VWFCP/ADAMTS13 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human VWFCP/ADAMTS13 protein (His tag)
PDEH100888-02 100 µg

Recombinant Human VWFCP/ADAMTS13 protein (His tag)

Sign In for Pricing
View Details