Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pituitary adenylate cyclase-activating polypeptide type I receptor (ADCYAP1R1)

This Recombinant Human Pituitary adenylate cyclase-activating polypeptide type I receptor (ADCYAP1R1) spans the amino acid sequence from region 21-468.

Product Specifications

Product Name Alternative

Pituitary adenylate cyclase-activating polypeptide type I receptor, PACAP type I receptor, PACAP-R-1, PACAP-R1

UniProt

P41586

Expression Region

21-468

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPEL FRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRE RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGV NGGTQLSILSKSSSQIRMSGLPADNLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAR-γ Polyclonal Antibody
RA20571-01 50 µL

PPAR-γ Polyclonal Antibody

Sign In for Pricing
View Details
PPAR-γ Polyclonal Antibody
RA20571-02 100 µL

PPAR-γ Polyclonal Antibody

Sign In for Pricing
View Details
CES2 Rabbit pAb
orb2708292-01 50 µL

CES2 Rabbit pAb

Sign In for Pricing
View Details
CES2 Rabbit pAb
orb2708292-02 100 µL

CES2 Rabbit pAb

Sign In for Pricing
View Details
Human Troponin I (TNI) ELISA Kit
MBS2709803-01 24 Strip Well

Human Troponin I (TNI) ELISA Kit

Sign In for Pricing
View Details
Human Troponin I (TNI) ELISA Kit
MBS2709803-02 48 Well

Human Troponin I (TNI) ELISA Kit

Sign In for Pricing
View Details