Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 7 (Htr7)

This Recombinant Rat 5-hydroxytryptamine receptor 7 (Htr7) spans the amino acid sequence from region 1-448.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 7, 5-HT-7, 5-HT7, 5-HT-X, GPRFO, Serotonin receptor 7

UniProt

P32305

Expression Region

1-448

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE ALKLAERPERSEFVLQNSDHCGKKGHDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgE (Fc) Antibody : HRP
OASB00909-1ML 1.0 mL

Human IgE (Fc) Antibody : HRP

Sign In for Pricing
View Details
DAXX CytoSection
TS427435P5 25 Slides

DAXX CytoSection

Sign In for Pricing
View Details
CDK4 (Cyclin-dependent Kinase 4, Cell Division Protein Kinase 4, PSK-J3) (MaxLight 750) discontinued
124784-ML750 100 µL

CDK4 (Cyclin-dependent Kinase 4, Cell Division Protein Kinase 4, PSK-J3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral human ARID5B shRNA (UAS) - Lentiviral human ARID5B shRNA (UAS, RFP) (25)
GTR15088115 1 Vial

Lentiviral human ARID5B shRNA (UAS) - Lentiviral human ARID5B shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
UCP3 Antibody
orb2680444-01 50 µL

UCP3 Antibody

Sign In for Pricing
View Details
UCP3 Antibody
orb2680444-02 100 µL

UCP3 Antibody

Sign In for Pricing
View Details