Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-2B adrenergic receptor (Adra2b)

This Recombinant Mouse Alpha-2B adrenergic receptor (Adra2b) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

P30545

Expression Region

1-450

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPHGLPQCELNQEAWYILASSIGS FFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPRPGPAAGGVPASAKVPTLV SPLSSVGEANGHPKPPREKEEGETPEDPEARALPPNWSALPRSVQDQKKGTSGATAEKGA EEDEEEVEECEPQTLPASPASVFNPPLQQPQTSRVLATLRGQVLLSKNVGVASGQWWRRR TQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRQWTQTGW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S100A9 (S100 Calcium Binding Protein A9) CLIA Kit
MBS2530658-01 96 Tests

Mouse S100A9 (S100 Calcium Binding Protein A9) CLIA Kit

Sign In for Pricing
View Details
Mouse S100A9 (S100 Calcium Binding Protein A9) CLIA Kit
MBS2530658-02 5x 96 Tests

Mouse S100A9 (S100 Calcium Binding Protein A9) CLIA Kit

Sign In for Pricing
View Details
PSMB8 Rabbit Polyclonal Antibody (Biotin)
orb1599029 100 µL

PSMB8 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
In Situ-1 Crystallization Plates; package of twenty (20) plates
InSitu-01CL-20 20 Plates

In Situ-1 Crystallization Plates; package of twenty (20) plates

Sign In for Pricing
View Details
SLC1A2 Protein Vector (Rat) (pPM-C-HA)
PV305412 500 ng

SLC1A2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae RutF Protein (aa 1-164) (strain ATCC 700721 / MGH 78578)
VAng-Cr5426-500gEcoli 500 µg (E. coli)

Recombinant Klebsiella Pneumoniae RutF Protein (aa 1-164) (strain ATCC 700721 / MGH 78578)

Sign In for Pricing
View Details